ENCAB000BNM
Antibody against Homo sapiens TRIM22
Homo sapiens
GM12878, HepG2, MCF-7
characterized to standards
Homo sapiens
any cell type or tissue
partially characterized
Homo sapiens
K562, HeLa-S3, liver
not characterized to standards
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA003575
- Lot ID
- A11983
- Characterized targets
- TRIM22 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- Tripartite motif-containing protein 22 recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- NEVVKECQEKLQVALQRLIKEDQEAEKLEDDIRQERTAWKNYIQIERQKILKGFNEMRVILDNEEQRELQKLEEGEVNVLDNLAAATDQLVQQRQDASTLISDLQRRLRGSSVEMLQDVIDVMKRSESWTLKKPKSVSKKLKSVFRV
- External resources
Characterizations
TRIM22 (Homo sapiens)
not submitted for review by lab
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: HEK293T, using the antibody HPA003575. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 57.0
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- Expt1121_5-TRIM22-HPA003575.JPG
TRIM22 (Homo sapiens)
HepG2
compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: HepG2, using the antibody HPA003575. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 57.0
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- Trim22 (ENCAB000BNM)_HepG2.jpg
TRIM22 (Homo sapiens)
MCF-7
compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: MCF-7, using the antibody HPA003575. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 57.0
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- Trim22 (ENCAB000BNM)_MCF7.jpg
TRIM22 (Homo sapiens)
GM12878
compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line GM12878 using the antibody HPA003575. Lane 1: input nuclear lysate. Lane 2: material immunoprecipitated with antibody. Lane 3: material immunoprecipitated using control IgG. Marked bands were excised from gel and subjected to analysis by mass spectrometry. Target molecular weight: 57.0.
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- TRIM22.jpg
TRIM22 (Homo sapiens)
compliant
- Caption
- IP followed by mass spectrometry. Briefly, protein was immunoprecipitated from GM12878 nuclear cell lysates using the antibody HPA003575, and the IP fraction was loaded on a 10% polyacrylamide gel (NuPAGEBis-Tris Gel) and separated with an Invitrogen NuPAGE electrophoresis system. The gel was stained by ColloidialCoomassie G-250 stain, gel fragments corresponding to the bands indicated were excised. Then proteins were trypsinized using the in-gel digestion method. Digested proteins were analyzed on an Orbitrap Elite mass spectrometer (Thermo Scientific) by the nanoLC-ESI-MS/MS technique. Peptides were identified by the SEQUEST algorithm and filtered with a high confidence threshold (Peptide false discovery rate < 1%, 2 unique peptides per protein minimum, mass error < 10 ppm).
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- TRIM22_HPA003575 final.pdf
TRIM22 (Homo sapiens)
GM12878K562HepG2HeLa-S3MCF-7liver
not compliant
- Caption
- Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order : GM12878, K562, HepG2, HelaS3, MCF7 and Liver using the antibody HPA002531. Molecular mass: 56947 Da
- Reviewer comment
- Band is not 50% of signal
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- TRIM22_HPA003575_WB_a.jpg
TRIM22 (Homo sapiens)
GM12878
compliant
- Caption
- b) Immunoprecipitation was performed on nuclear extracts from the cell line: GM12878, using the antibody HPA003575 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG. Expected size ~57 kDa.
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- TRIM22_HPA003575_WB_b.jpg